PANK2 (Pantothenate Kinase 2, Mitochondrial, hPanK2, Pantothenic Acid Kinase 2, C20orf48, FLJ11729, FLJ17232, MGC15053)

Size

£685.00

SKU:: 130856
Purity:: Purified by Protein A affinity chromatography.
Storage Conditions:: -20°C
Supplier:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant corresponding to aa205-260 from human PANK2 (NP_705902) with GST tag. MW of the GST tag alone is 26kD.
Clone:: 2B12
Format:: Supplied as a liquid in PBS, pH 7.2.
Extra Details:: May be the master regulator of the CoA biosynthesis. Applications: Suitable for use in ELISA, Western Blot and Immunohistochemistry. Other applications not tested. Recommended Dilution: Immunohistochemistry (Formalin fixed paraffin embedded): 1-10ug/ml Optimal dilutions to be determined by the researcher. AA Sequence: IGDLQLCKLDELDCLIKGILYIDSVGFNGRSQCYYFENPADSEKCQKLPFDLKNP Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.