PALM2 (Paralemmin 2, Paralemmin-2)

Size

£685.00

SKU:: 130851
Purity:: Purified by Protein A affinity chromatography.
Storage Conditions:: -20°C
Supplier:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant corresponding to aa321-412 from human PALM2 (NP_443749) with GST tag. MW of the GST tag alone is 26kD.
Clone:: 1A8
Format:: Supplied as a liquid in PBS, pH 7.2.
Extra Details:: Paralemmin 2 (PALM2) is expressed in infantile heart and muscle, and fibroblasts. The specific function of paralemmin 2 is unknown. It is adjacent to the AKAP2 gene on chromosome 9q31-q33 and can be differentially expressed as a natural AKAP2-PALM2 chimeric protein. Applications: Suitable for use in ELISA and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: EDEEETKKVLGYDETIKAELVLIDEDDEKSLREKTVTDVSTIDGNAAELVSGRPVSDTTEPSSPEGKEESLATEPAPGTQKKKRCQCCVVM Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.