130844-BIOTIN

PAK2 (Serine/Threonine-protein Kinase PAK 2, Gamma-PAK, PAK65, S6/H4 Kinase, p21-activated Kinase 2, PAK-2, p58) (Biotin)

Size

£914.00

SKU:: 130844-BIOTIN
Purity:: Purified by Protein A affinity chromatography.
Storage Conditions:: -20°C
Supplier:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant corresponding to aa131-230 from human PAK2 (NP_002568) with GST tag. MW of the GST tag alone is 26kD.
Clone:: 1E1
Format:: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.
Extra Details:: The PAK (p21-activated kinase) family of serine/threonine kinases plays an important role in multiple cellular processes, including cytoskeletal reorganization, MAPK signaling, apoptotic signaling, etc. Binding of Rac/cdc42 to the CRIB (or PBD) domain at the N-terminal region of PAK causes autophosphorylation and conformational change of PAK. Phosphorylation of Ser21 of PAK1 or Ser20 of PAK2 regulates its binding with the adaptor protein Nck. Applications: Suitable for use in ELISA and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: DSNTVKQKYLSFTPPEKDGFPSGTPALNAKGTEAPAVVTEEEDDDEETAPPVIAPRPDHTKSIYTRSVIDPVPAPVGDSHVDGAAKSLDKQKKKTKMTDE Storage and Stability: Store product at 4°C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20°C. Aliquots are stable at -20°C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Note: Applications are based on unconjugated antibody.

Shipping Conditions:: Blue Ice