PAI2 (Plasminogen Activator Inhibitor 2, PAI-2, Placental Plasminogen Activator Inhibitor, Monocyte Arg-serpin, Urokinase Inhibitor, Serpin B2, PLANH2, SERPINB2)

Size

£685.00

SKU:: 130836
Purity:: Purified by Protein A affinity chromatography.
Storage Conditions:: -20°C
Supplier:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant corresponding to aa1-100 from human SERPINB2 (AAH12609) with GST tag. MW of the GST tag alone is 26kD.
Clone:: 3A9
Format:: Supplied as a liquid in PBS, pH 7.2.
Extra Details:: PAI2 inhibits urokinase-type plasminogen activator. The monocyte derived PAI-2 is distinct from the endothelial cell-derived PAI-1. Applications: Suitable for use in ELISA, Western Blot and Immunoprecipitation. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: MEDLCVANTLFALNLFKHLAKASPTQNLFLSPWSISSTMAMVYMGSRGSTEDQMAKVLQFNEVGANAVTPMTPENFTSCGFMQQIQKGSYPDAILQAQAA Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.