130818-FITC
PADI4 (Protein-arginine Deiminase Type IV, Protein-arginine Deiminase Type-4, Peptidylarginine Deiminase IV, HL-60 PAD, PADI5, PDI5) (FITC)
Size
£914.00
- SKU:
- 130818-FITC
- Purity:
- Purified by Protein A affinity chromatography.
- Storage Conditions:
- -20°C
- Supplier:
- United States Biological
- Host:
- Mouse
- Immunogen:
- Partial recombinant corresponding to aa2-111 from PADI4 with GST tag. MW of the GST tag alone is 26kD.
- Clone:
- 4D8
- Format:
- Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Fluorescein isothiocyanate (FITC).
- Extra Details:
- PADI4 (Protein-arginine deiminase type-4) is a member of a family of enzymes responsible for the conversion of arginine residues to citrulline residues via catalysis of the deimination of the arginine residues. PADI4 down-regulates histone H3 and H4 arginine methylation, both by preventing arginine methylation by CARM1 and HRMT1L2/PRMT1 and by converting methylarginine to citrulline. This protein may play a role in granulocyte and macrophage development leading to inflammation and immune response. Applications: Suitable for use in Immunofluorescence, FLISA and Western Blot. Other applications not tested. Recommended Dilution: Immunofluorescence: 10ug/ml Optimal dilutions to be determined by the researcher. AA Sequence: AQGTLIRVTPEQPTHAVCVLGTLTQLDICSSAPEDCTSFSINASPGVVVDIAHSPPAKKKSTGSSTWPLDPGVEVTLTMKAASGSTGDQKVQISYYGPKTPPVKALLYL* Storage and Stability: Store product at 4°C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20°C. Aliquots are stable at -20°C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: FITC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Note: Applications are based on unconjugated antibody.
- Shipping Conditions:
- Blue Ice