130815-BIOTIN
PACSIN2 (Protein Kinase C and Casein Kinase Substrate in Neurons Protein 2, Syndapin 2, Syndapin-II, SDPII) (Biotin)
Size
£914.00
- SKU:
- 130815-BIOTIN
- Purity:
- Purified by Protein A affinity chromatography.
- Storage Conditions:
- -20°C
- Supplier:
- United States Biological
- Host:
- Mouse
- Immunogen:
- Partial recombinant corresponding to aa368-429 from PACSIN2 (NP_009160) with GST tag. MW of the GST tag alone is 26kD.
- Clone:
- 3D6
- Format:
- Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.
- Extra Details:
- Plays a role in the formation of normal, flask-shaped caveolae at the cell membrane. Recruits DNM2 to caveolae, and thereby plays a role in caveola-mediated endocytosis. Plays a role in intracellular vesicle-mediated transport. Binds to membranes via its F-BAR domain and promotes membrane tubulation. Plays a role in the internalization of cell-surface receptors. Is not required for internalization of EGFR after EGF stimulus, but contributes to the internalization of EGFR in the absence of EGF stimulus. Applications: Suitable for use in ELISA, Western Blot and Immunohistochemistry. Other applications not tested. Recommended Dilution: Immunohistochemistry (Formalin fixed paraffin embedded): 3ug/ml Optimal dilutions to be determined by the researcher. AA Sequence: DDTGSTVSEKEDIKAKNVSSYEKTQSYPTDWSDDESNNPFSSTDANGDSNPFDDDATSGTE* Storage and Stability: Store product at 4°C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20°C. Aliquots are stable at -20°C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Note: Applications are based on unconjugated antibody.
- Shipping Conditions:
- Blue Ice