130815-APC
PACSIN2 (Protein Kinase C and Casein Kinase Substrate in Neurons Protein 2, Syndapin 2, Syndapin-II, SDPII) (APC)
Size
£927.00
- SKU:
- 130815-APC
- Purity:
- Purified by Protein A affinity chromatography.
- Storage Conditions:
- 4°C Do Not Freeze
- Supplier:
- United States Biological
- Host:
- Mouse
- Immunogen:
- Partial recombinant corresponding to aa368-429 from PACSIN2 (NP_009160) with GST tag. MW of the GST tag alone is 26kD.
- Clone:
- 3D6
- Format:
- Supplied as a liquid in PBS, pH 7.2. Labeled with Allophycocyanin (APC).
- Extra Details:
- Plays a role in the formation of normal, flask-shaped caveolae at the cell membrane. Recruits DNM2 to caveolae, and thereby plays a role in caveola-mediated endocytosis. Plays a role in intracellular vesicle-mediated transport. Binds to membranes via its F-BAR domain and promotes membrane tubulation. Plays a role in the internalization of cell-surface receptors. Is not required for internalization of EGFR after EGF stimulus, but contributes to the internalization of EGFR in the absence of EGF stimulus. Applications: Suitable for use in FLISA, Western Blot and Immunohistochemistry. Other applications not tested. Recommended Dilution: Immunohistochemistry (Formalin fixed paraffin embedded): 3ug/ml Optimal dilutions to be determined by the researcher. AA Sequence: DDTGSTVSEKEDIKAKNVSSYEKTQSYPTDWSDDESNNPFSSTDANGDSNPFDDDATSGTE* Storage and Stability: Store product at 4°C in the dark. DO NOT FREEZE! Stable at 4°C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: APC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap. Note: Applications are based on unconjugated antibody.
- Shipping Conditions:
- Blue Ice