130750-PE
OSBPL8 (Oxysterol-binding Protein-related Protein 8, ORP-8, OSBP-related Protein 8, DKFZp686A11164, MGC126578, MGC133203, KIAA1451, ORP8, OSBP10) (PE)
Size
£914.00
- SKU:
- 130750-PE
- Purity:
- Purified by Protein A affinity chromatography.
- Storage Conditions:
- 4°C Do Not Freeze
- Supplier:
- United States Biological
- Host:
- Mouse
- Immunogen:
- Partial recombinant corresponding to aa244-347 from human OSBPL8 (NP_065892) with GST tag. MW of the GST tag alone is 26kD.
- Clone:
- 4H6
- Format:
- Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-Phycoerythrin (PE).
- Extra Details:
- ORP8 is a member of the oxysterol-binding protein related protein family. In humans, the gene family consists of 12 members, and extensive splice variation increases the number of encoded protein products substantially. The ORPs have been implicated as sterol sensors that regulate a number of cellular functions including sterol and neutral lipid metabolism, intracellular lipid transport, membrane trafficking and cell signaling. ORP8 has been recently shown to act as a sterol sensor that affects the reverse cholesterol transport process via modulation of ABCA1 expression and macrophage cholesterol efflux. Applications: Suitable for use in FLISA and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: IIRATSESDGRCWMDALELALKCSSLLKRTMIREGKEHDLSVSSDSTHVTFYGLLRANNLHSGDNFQLNDSEIERQHFKDQDMYSDKSDKENDQEHDESDNEV Storage and Stability: Store product at 4°C in the dark. DO NOT FREEZE! Stable at 4°C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap. Note: Applications are based on unconjugated antibody.
- Shipping Conditions:
- Blue Ice