OMP (Olfactory Marker Protein, Olfactory Neuronal-specific Protein)

Size

£685.00

SKU:: 130718
Purity:: Purified by Protein A affinity chromatography.
Storage Conditions:: -20°C
Supplier:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant protein corresponding to aa65-163 from human OMP with GST tag. MW of the GST tag alone is 26kD.
Clone:: 2B7
Format:: Supplied as a liquid in PBS, pH 7.4.
Extra Details:: Olfactory marker protein (OMP) is an abundant, 19kD, cytosolic protein that is almost exclusively expressed in mature, functioning, olfactory neurons but not in the neural precursor basal cells. The OMP gene structure and protein sequence are highly conserved between mouse, rat and human. Its tissue-specific expression in the receptor cells together with the results of the mouse knockout studies show that OMP represents a novel modulatory component of the odor detection/signal transduction cascade. May act as a modulator of the olfactory signal-transduction cascade. Applications: Suitable for use in ELISA and Western Blot. Other applications not tested. Recommended Dilutions: Optimal dilutions to be determined by the researcher. Amino Acid Sequence: FERWNVVLDKPGKVTITGTSQNWTPDLTNLMTRQLLDPTAIFWRKEDSDAIDWNEADALEFGERLSDLAKIRKVMYFLVTFGEGVEPANLKASVVFNQL Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months after receipt. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Shipping Conditions:: Blue Ice