130718-ML650
OMP (Olfactory Marker Protein, Olfactory Neuronal-specific Protein) (MaxLight 650)
Size
£914.00
- SKU:
- 130718-ML650
- Purity:
- Purified by Protein A affinity chromatography.
- Storage Conditions:
- 4°C Do Not Freeze
- Supplier:
- United States Biological
- Host:
- Mouse
- Immunogen:
- Partial recombinant corresponding to aa65-163 from human OMP with GST tag. MW of the GST tag alone is 26kD.
- Clone:
- 2B7
- Format:
- Supplied as a liquid in PBS, pH 7.4. No preservative added. Labeled with MaxLight™650.
- Extra Details:
- MaxLight™650 is a new Far-IR stable dye conjugate comparable to Alexa Fluor™647, DyLight™649, Cy5™ and offers better labeling efficiency, brighter imaging and increased immunodetection. Absorbance (655nm); Emission (676nm); Extinction Coefficient 250,000. Olfactory marker protein (OMP) is an abundant, 19kD, cytosolic protein that is almost exclusively expressed in mature, functioning, olfactory neurons but not in the neural precursor basal cells. The OMP gene structure and protein sequence are highly conserved between mouse, rat and human. Its tissue-specific expression in the receptor cells together with the results of the mouse knockout studies show that OMP represents a novel modulatory component of the odor detection/signal transduction cascade. May act as a modulator of the olfactory signal-transduction cascade. Applications: Suitable for use in FLISA and Western Blot. Other applications not tested. Recommended Dilutions: Optimal dilutions to be determined by the researcher. Amino Acid Sequence: FERWNVVLDKPGKVTITGTSQNWTPDLTNLMTRQLLDPTAIFWRKEDSDAIDWNEADALEFGERLSDLAKIRKVMYFLVTFGEGVEPANLKASVVFNQL Storage and Stability: Store product at 4°C in the dark. DO NOT FREEZE! Stable at 4°C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight™650 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap. Note: Applications are based on unconjugated antibody.
- Shipping Conditions:
- Blue Ice