OMD (Osteomodulin, Keratan Sulfate Proteoglycan Osteomodulin, KSPG Osteomodulin, Osteoadherin, OSAD, SLRR2C, UNQ190/PRO216)

Size

£685.00

SKU:: 130716
Purity:: Purified by Protein A affinity chromatography.
Storage Conditions:: 4°C Do Not Freeze
Supplier:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant corresponding to aa274-384 from human OMD (NP_005005) with GST tag. MW of the GST tag alone is 26kD.
Clone:: 1E10
Format:: Supplied as a liquid in PBS, pH 7.2.
Extra Details:: OMD may be implicated in biomineralization processes. This protein has a function in binding of osteoblasts via the alpha(V)beta(3)-integrin. Applications: Suitable for use in ELISA and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: YNIFNLPNIVELSVGHNKLKQAFYIPRNLEHLYLQNNEIEKMNLTVMCPSIDPLHYHHLTYIRVDQNKLKEPISSYIFFCFPHIHTIYYGEQRSTNGQTIQLKTQVFRRF Storage and Stability: May be stored at 4°C. For long-term storage, aliquot and store at 4°C. Do not freeze. Aliquots are stable for 12 months after receipt. For maximum recovery of product, centrifuge the original vial prior to removing the cap. Further dilutions can be made in assay buffer.