130709-PE
OLIG1 (Oligodendrocyte Transcription Factor 1, Oligo1, Class B Basic Helix-loop-helix Protein 6, bHLHb6, Class E Basic Helix-loop-helix Protein 21, bHLHe21, BHLHB6, BHLHE21) (PE)
Size
£914.00
- SKU:
- 130709-PE
- Purity:
- Purified by Protein A affinity chromatography.
- Storage Conditions:
- 4°C Do Not Freeze
- Supplier:
- United States Biological
- Host:
- Mouse
- Immunogen:
- Full length recombinant corresponding to aa80-159 from human OLIG1 (NP_620450.1) with GST tag. MW of the GST tag alone is 26kD.
- Clone:
- 2B11
- Format:
- Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-Phycoerythrin (PE).
- Extra Details:
- Olig1 and Olig2, which have been implicated in oligodendrogenesis, are expressed in the region of the ventral ventricular zone of late embryonic spinal cord where oligodendrocyte progenitors appear. Olig3 is transiently expressed in different types of progenitors of embryonic central nervous system and then disappears in the course of development. In adult, expression of Olig3 is primarily detected in neural tissues. Applications: Suitable for use in FLISA, Western Blot and Immunoprecipitation. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: PDAKEEQQQQLRRKINSRERKRMQDLNLAMDALREVILPYSAAHCQGAPGRKLSKIATLLLARNYILLLGSSLQELRRAL Storage and Stability: Store product at 4°C in the dark. DO NOT FREEZE! Stable at 4°C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap. Note: Applications are based on unconjugated antibody.
- Shipping Conditions:
- Blue Ice