130645-ML650
NUMA1 (Nuclear Mitotic Apparatus Protein 1, NuMA Protein, SP-H Antigen, NUMA) (MaxLight 650)
Size
£914.00
- SKU:
- 130645-ML650
- Purity:
- Purified by Protein A affinity chromatography.
- Storage Conditions:
- 4°C Do Not Freeze
- Supplier:
- United States Biological
- Host:
- Mouse
- Immunogen:
- Partial recombinant corresponding to aa200-307 from human NUMA1 with GST tag. MW of the GST tag alone is 26kD.
- Clone:
- 1C5
- Format:
- Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight™650.
- Extra Details:
- MaxLight™650 is a new Far-IR stable dye conjugate comparable to Alexa Fluor™647, DyLight™649, Cy5™ and offers better labeling efficiency, brighter imaging and increased immunodetection. Absorbance (655nm); Emission (676nm); Extinction Coefficient 250,000. NuMA (nuclear mitotic apparatus) is a long coil-coiled protein that plays a role in the interphase and mitosis phases of a cell cycle. In interphase, it has been hypothesized to play a structural role in the nucleoskeleton that may be important in nuclear organization and functions. During mitosis, it is associated with spindle microtubule organization and chromosome positioning. Therefore, this antibody is useful as a cell cycle marker. Applications: Suitable for use in FLISA, Western Blot and Immunoprecipitation. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: SPASPMGDILQTPQFQMRRLKKQLADERSNRDELELELAENRKLLTEKDAQIAMMQQRIDRLALLNEKQAASPLEPKELEELRDKNESLTMRLHETLKQCQDLKTEK Storage and Stability: Store product at 4°C in the dark. DO NOT FREEZE! Stable at 4°C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight™650 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap. Note: Applications are based on unconjugated antibody.
- Shipping Conditions:
- Blue Ice