130635-ML550
NUDT4 (Diphosphoinositol Polyphosphate Phosphohydrolase 2, DIPP-2, Diadenosine 5',5'''-P1,P6-hexaphosphate Hydrolase 2, Nucleoside Diphosphate-linked Moiety X Motif 4, Nudix Motif 4, DIPP2, KIAA0487, HDCMB47P) (MaxLight 550)
Size
£914.00
- SKU:
- 130635-ML550
- Purity:
- Purified by Protein A affinity chromatography.
- Storage Conditions:
- 4°C Do Not Freeze
- Supplier:
- United States Biological
- Host:
- Mouse
- Immunogen:
- Full length recombinant corresponding to aa1-182 from NUDT4 (AAH12069) with GST tag. MW of the GST tag alone is 26kD.
- Clone:
- 2F2
- Format:
- Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight™550.
- Extra Details:
- MaxLight™550 is a new Yellow-Green photostable dye conjugate comparable to Alexa Fluor™546, 555, DyLight™549 , Cy3™, TRITC and offers better labeling efficiency, brighter imaging and increased immunodetection. Absorbance (550nm); Emission (575nm); Extinction Coefficient 150,000. NUDT4 (Nudix (nucleoside diphosphate linked moiety X)-type motif 4) is a member of the DIPP subfamily of Nudix proteins which hydrolyze specific diphosphoinositol polyphosphates and diadenosine polyphosphates. NUDT4 cleaves a beta-phosphate from the diphosphate groups in PP-InsP5 (diphosphoinositol pentakisphosphate), PP-InsP4 and [PP]2-InsP4 (bisdiphosphoinositol tetrakisphosphate), suggesting that it may play a role in signal transduction. It is also able to catalyze the hydrolysis of dinucleoside oligophosphate Ap6A, but not Ap5A. Applications: Suitable for use in FLISA and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: MMKFKPNQTRTYDREGFKKRAACLCFRSEQEDEVLLVSSSRYPDQWIVPGGGMEPEEEPGGAAVREVYEEAGVKGKLGRLLGIFEQNQDRKHRTYVYVLTVTEILEDWEDSVNIGRKREWFKVEDAIKVLQCHKPVHAEYLEKLKLGCSPANGNSTVPSLPDNNALFVTAAQTSGLPSSVR* Storage and Stability: Store product at 4°C in the dark. DO NOT FREEZE! Stable at 4°C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight™550 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap. Note: Applications are based on unconjugated antibody.
- Shipping Conditions:
- Blue Ice