130552-ML650
NR2F2 (COUP Transcription Factor 2, COUP-TF2, Apolipoprotein A-I Regulatory Protein 1, ARP-1, COUP Transcription Factor II, COUP-TF II, Nuclear Receptor Subfamily 2 Group F Member 2, ARP1, TFCOUP2) (MaxLight 650)
Size
£914.00
- SKU:
- 130552-ML650
- Application:
- FLISA
- Purity:
- Purified by Protein A affinity chromatography.
- Storage Conditions:
- 4°C Do Not Freeze
- Supplier:
- United States Biological
- Host:
- Mouse
- Immunogen:
- Partial recombinant corresponding to aa153-241 from human NR2F2 (NP_066285) with GST tag. MW of the GST tag alone is 26kD.
- Clone:
- 1D8
- Format:
- Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight™650.
- Extra Details:
- MaxLight™650 is a new Far-IR stable dye conjugate comparable to Alexa Fluor™647, DyLight™649, Cy5™ and offers better labeling efficiency, brighter imaging and increased immunodetection. Absorbance (655nm); Emission (676nm); Extinction Coefficient 250,000. COUP-TFII, a NR2 Hepatocyte NF4-Like receptor, has been shown to affect neuronal development and differentiation, homeostasis in various Human tissues, mesenchymal-epithelial interactions during organogenesis, and the development of the cardiovascular system. COUP-TFII interacts with and modulates several nuclear receptors, including estrogen receptor alpha (ER alpha), thyroid hormone receptors (TR), PPAR alpha, and retinoic acid receptors (RAR). Mice lacking COUP-TFII show abnormal heart and vascular development. COUP-TFII expression has been documented in Human adrenal, lung, kidney, liver, spleen, skeletal muscle, and breast. ESTs have been isolated from Human tissue libraries, including cancerous adrenal, bladder, brain, breast, colon, head/neck, kidney, lung, ovary, pancreas, pituitary, prostate, skeletal muscle, skin, smooth muscle, stomach, synovium, and uterus, and normal brain, adipose, adrenal, blood, brain, breast, cervix, ear, embryo, gallbladder, ganglion, heart, kidney, liver/spleen, lung, ovary, placenta, prostate, skin, spleen, testis, uterus, and vessel. Applications: Suitable for use in FLISA. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: RMPPTQPTHGQFALTNGDPLNCHSYLSGYISLLLRAEPYPTSRFGSQCMQPNNIMGIENICELAARMLFSAVEWARNIPFFPDLQITD Storage and Stability: Store product at 4°C in the dark. DO NOT FREEZE! Stable at 4°C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight™650 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap. Note: Applications are based on unconjugated antibody.
- Shipping Conditions:
- Blue Ice