130543-ML490
NR2C2 (Nuclear Receptor Subfamily 2 Group C Member 2, Orphan Nuclear Receptor TAK1, Orphan Nuclear Receptor TR4, Testicular Receptor 4, TAK1, TR4) (MaxLight 490)
Size
£914.00
- SKU:
- 130543-ML490
- Purity:
- Purified by Protein A affinity chromatography.
- Storage Conditions:
- 4°C Do Not Freeze
- Supplier:
- United States Biological
- Host:
- Mouse
- Immunogen:
- Partial recombinant corresponding to aa43-152 from human NR2C2 (NP_003289) with GST tag. MW of the GST tag alone is 26kD.
- Clone:
- 2A5
- Format:
- Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight™490.
- Extra Details:
- MaxLight™490 is a new Blue-Green photostable dye conjugate comparable to DyLight™488, Alexa Fluor™488 and offers better labeling efficiency, brighter imaging and increased immunodetection. Absorbance (491nm); Emission (515nm); Extinction Coefficient 73,000. TR4 is a NR2 Hepatocyte NF4-Like nuclear hormone receptor and transcription factor related to the orphan receptors TR2, COUP-TFI, and ARP-1. TR4 has been shown to affect the proliferation and maturation of brain structures, neurogenesis, the regulation of myeloid progenitor cell proliferation and development, and retinoid-mediated signaling pathways. TR4 binds to target DNA as a homodimer or a monomer, and has been shown to affect transcription of ciliary neurotrophic factor receptor (CNTFR alpha), luteinizing hormone receptor, and human steroid 21-hydroxylase genes. During development, the expression of TR4 in human and rat brain correlates with the progression of neuronal maturation. TR4 becomes progressively restricted to the hypothalamus and cerebellum in older embryos and adults. Recently, it has been shown that TR4 can suppress estrogen receptor function via direct protein-protein interaction. Three rat and two human TR4 mRNA splice variants have been documented. Applications: Suitable for use in FLISA, Western Blot and Immunohistochemistry. Other applications not tested. Recommended Dilution: Immunohistochemistry (Formalin fixed paraffin embedded): 3ug/ml Optimal dilutions to be determined by the researcher. AA Sequence: KIVTDQQTGQKIQIVTAVDASGSPKQQFILTSPDGAGTGKVILASPETSSAKQLIFTTSDNLVPGRIQIVTDSASVERLLGKTDVQRPQVVEYCVVCGDKASGRHYGAVS Storage and Stability: Store product at 4°C in the dark. DO NOT FREEZE! Stable at 4°C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight™490 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap. Note: Applications are based on unconjugated antibody.
- Shipping Conditions:
- Blue Ice