NR0B1 (Nuclear Receptor Subfamily 0 Group B Member 1, Nuclear Receptor DAX-1, DSS-AHC Critical Region On The X Chromosome Protein 1, DAX1, AHC, DAX1)

Size

£685.00

SKU:: 130525
Purity:: Purified by Protein A affinity chromatography.
Storage Conditions:: 4°C Do Not Freeze
Supplier:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant corresponding to aa361-470 from human NR0B1 (NP_000466) with GST tag. MW of the GST tag alone is 26KD.
Clone:: 1F10
Format:: Supplied as a liquid in PBS, pH 7.2.
Extra Details:: NROB1 contains a DNA-binding domain and acts as a dominant-negative regulator of transcription which is mediated by the retinoic acid receptor. This protein also functions as an anti-testis gene by acting antagonistically to Sry. Mutations in the gene for NROB1 result in both X-linked congenital adrenal hypoplasia and hypogonadotropic hypogonadism. Applications: Suitable for use in Immunofluorescence, ELISA and Western Blot. Other applications not tested. Recommended Dilution: Immunofluorescence: 10ug/ml Optimal dilutions to be determined by the researcher. AA Sequence: IKCFLSKCWSLNISTKEYAYLKGTVLFNPDVPGLQCVKYIQGLQWGTQQILSEHTRMTHQGPHDRFIELNSTLFLLRFINANVIAELFFRPIIGTVSMDDMMLEMLCTKI Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.