NPY (Neuropeptide Y, PYY4)

Size

£685.00

SKU:: 130515
Purity:: Purified by Protein A affinity chromatography.
Storage Conditions:: -20°C
Supplier:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant corresponding to aa29-98 from human NPY (AAH29497) with GST tag. MW of the GST tag alone is 26kD.
Clone:: 3B5
Format:: Supplied as a liquid in PBS, pH 7.2.
Extra Details:: Neuropeptide Y (NPY) is a 36aa residue peptide with sequence and 3-D structural homology with PYY and pancreatic polypeptide (PP). NPY serves as a neurotransmitter and is exclusively localized in neurons in the central and peripheral nervous system. NPY is associated with the regulation of heart rate and food intake in several mammalian species. Applications: Suitable for use in ELISA and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: YPSKPDNPGEDAPAEDMARYYSALRHYINLITRQRYGKRSSPETLISDLLMRESTENVPRTRLEDPAMW Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.