130491-ML650
NPC1 (Niemann-Pick C1 Protein) (MaxLight 650)
Size
£914.00
- SKU:
- 130491-ML650
- Purity:
- Purified by Protein A affinity chromatography.
- Storage Conditions:
- 4°C Do Not Freeze
- Supplier:
- United States Biological
- Host:
- Mouse
- Immunogen:
- Partial recombinant corresponding to aa151-250 from human NPC1 (AAH63302) with GST tag. MW of the GST tag alone is 26kD.
- Clone:
- 4H2
- Format:
- Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight™650.
- Extra Details:
- MaxLight™650 is a new Far-IR stable dye conjugate comparable to Alexa Fluor™647, DyLight™649, Cy5™ and offers better labeling efficiency, brighter imaging and increased immunodetection. Absorbance (655nm); Emission (676nm); Extinction Coefficient 250,000. Niemann-Pick C1 (NPC1) disease is characterized by cholesterol accumulation in lysosomes and aberrant feedback regulation of cellular cholesterol homeostasis. The gene responsible for the disease is NPC1, which encodes a protein with five transmembrane domains. NPC1 protein has homology with the resistance-nodulation-division (RND) family of prokaryotic permeases and may normally function as a transmembrane efflux pump. NPC1 uses a proton motive force to remove accumulated acriflavine from the endosomal/lysosomal (E/L) system. NPC1 can function to transport lipophilic molecules but not cholesterol, out of the E/L system. The fact that NPC1 can transport acriflavine and fatty acids suggest that this permease may have a "multidrug" transport function, part of which is its housekeeping role in cellular cholesterol homeostasis. Expression of NPC1 in E. coli facilitated the transport of acriflavine across the plasma membrane, causing cytosolic accumulation and resulting in transport of oleic acid, but not cholesterol-oleate across the plasma membrane, establishing NPC1 as a eukaryotic member of the RND permease family. Applications: Suitable for use in FLISA and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: GFANAMYNACRDVEAPSSNDKALGLLCGKDADACNATNWIEYMFNKDNGQAPFTITPVFSDFPVHGMEPMNNATKGCDESVDEVTAPCSCQDCSIVCGPK Storage and Stability: Store product at 4°C in the dark. DO NOT FREEZE! Stable at 4°C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight™650 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap. Note: Applications are based on unconjugated antibody.
- Shipping Conditions:
- Blue Ice