NPAS4 (Neuronal PAS Domain-containing Protein 4, Neuronal PAS4, Class E Basic Helix-loop-helix Protein 79, bHLHe79, HLH-PAS Transcription Factor NXF, PAS Domain-containing Protein 10, BHLHE79, NXF, PASD10)

Size

£685.00

SKU:: 130490
Purity:: Purified by Protein A affinity chromatography.
Storage Conditions:: -20°C
Supplier:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant protein corresponding to aa704-802 from human NPAS4 (NP_849195) with GST tag. MW of the GST tag alone is 26kD.
Clone:: 4E4
Format:: Supplied as a liquid in PBS, pH 7.2.
Extra Details:: Acts as a transcriptional activator in the presence of ARNT. Can activate the CME (CNS midline enhancer) element and the expression of the drebrin gene. Applications: Suitable for use in ELISA and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. Amino Acid Sequence: FLEETPVEDIFMDLSTPDPSEEWGSGDPEAEGPGGAPSPCNNLSPEDHSFLEDLATYETAFETGVSAFPYDGFTDELHQLQSQVQDSFHEDGSGGEPTF Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.