130479-BIOTIN
NOTCH3 (Neurogenic Locus Notch Homolog Protein 3, Notch 3, Notch 3 Extracellular Truncation, Notch 3 Intracellular Domain) (Biotin)
Size
£914.00
- SKU:
- 130479-BIOTIN
- Purity:
- Purified by Protein A affinity chromatography.
- Storage Conditions:
- -20°C
- Supplier:
- United States Biological
- Host:
- Mouse
- Immunogen:
- Partial recombinant corresponding to aa47-157 from human NOTCH3 (NP_000426) with GST tag. MW of the GST tag alone is 26kD.
- Clone:
- 1G5
- Format:
- Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.
- Extra Details:
- The Notch protein sits like a trigger penetrating the cell membrane, with part of it inside and part outside. Proteins when binding to the exterior part cause the release of a portion of the interior part, which typically then makes its way to the cell nucleus to alter gene expression. The Notch gene belongs to a family of epidermal growth factor (EGF)-like homeotic genes, which encode transmembrane proteins with a variable number of cysteine rich EGF like repeats in the extracellular region. Four notch genes have been described in mammals: Notch1,Notch2, Notch3 and Notch4(Int3), which have been implicated in the differentiation of the nervous system and other structures. The EG- like proteins Delta and Serrate have been identified as ligands of Notch1. Applications: Suitable for use in ELISA and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: SPCANGGRCTQLPSREAACLCPPGWVGERCQLEDPCHSGPCAGRGVCQSSVVAGTARFSCRCPRGFRGPDCSLPDPCLSSPCAHGARCSVGPDGRFLCSCPPGYQGRSCR Storage and Stability: Store product at 4°C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20°C. Aliquots are stable at -20°C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Note: Applications are based on unconjugated antibody.
- Shipping Conditions:
- Blue Ice