NOTCH2NL (Notch Homolog 2 N-terminal-like Protein, N2N, FLJ35032, FLJ55807)

Size

£685.00

SKU:: 130478
Purity:: Purified by Protein A affinity chromatography.
Storage Conditions:: -20°C
Supplier:: United States Biological
Host:: Mouse
Immunogen:: Full length recombinant protein corresponding to aa1-237 from human NOTCH2NL (AAH19835) with GST tag. MW of the GST tag alone is 26kD.
Clone:: 2G12-2A5
Format:: Supplied as a liquid in PBS, pH 7.2.
Extra Details:: May function in the Notch signaling pathway and regulate neutrophil differentiation. Applications: Suitable for use in Immunofluorescence, ELISA and Western Blot. Other applications not tested. Recommended Dilutions: Immunofluorescence: 10ug/ml Sandwich ELISA: The detection limit is ~0.1ng/ml as a capture antibody. Optimal dilutions to be determined by the researcher. Amino Acid Sequence: MCVTYHNGTGYCKCPEGFLGEYCQHRDPCEKNRCQNGGTCVAQAMLGKATCRCASGFTGEDCQYSTSHPCFVSRPCLNGGTCHMLSRDTYECTCQVGFTGKECQWTDACLSHPCANGSTCTTVANQFSCKCLTGFTGQKCETDVNECDIPGHCQHGGICLNLPGSYQCQCLQGFTGQYCDSLYVPCAPSPCVNGGTCRQTGDFTFECNCLPETVRRGTELWERDREVWNGKEHDEN* Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.