NOTCH1 (Notch 1, Neurogenic Locus Notch Homolog Protein 1, hN1, Translocation-associated Notch Protein TAN-1, TAN1)

Size

£685.00

SKU:: 130477
Purity:: Purified by Protein A affinity chromatography.
Storage Conditions:: -20°C
Supplier:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant corresponding to aa23-133 from human NOTCH1 (NP_060087) with GST tag. MW of the GST tag alone is 26kD.
Clone:: 4G1
Format:: Supplied as a liquid in PBS, pH 7.2.
Extra Details:: Notch1 is a transmembrane protein functioning in development and the determination of cell fate. During maturation, the notch molecule is cleaved by a furin-like convertase at its extracellular domain. Upon binding to a ligand such as Delta1, or upon extracellular calcium depletion, the carboxy-terminal notch1 fragment is released and further cleaved between Gly1743 and Val1744. The resulting activated cytosolic fragment translocates to the nucleus where it activates transcription. Applications: Suitable for use in ELISA and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: RCSQPGETCLNGGKCEAANGTEACVCGGAFVGPRCQDPNPCLSTPCKNAGTCHVVDRRGVADYACSCALGFSGPLCLTPLDNACLTNPCRNGGTCDLLTLTEYKCRCPPG Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.