NOL4 (NOLP, Nucleolar Protein 4, CT125, Nucleolar-localized Protein, HRIHFB2255)

Size

£685.00

SKU:: 130460
Purity:: Purified by Protein A affinity chromatography.
Storage Conditions:: -20°C
Supplier:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant corresponding to aa425-524 from NOL4 (NP_003778) with GST tag. MW of the GST tag alone is 26kD.
Clone:: 2A10
Format:: Supplied as a liquid in PBS, pH 7.2.
Extra Details:: NOL4 is a nucleolar protein which is predominantly expressed in fetal brain, adult brain and testis. Its function has not yet been determined. Applications: Suitable for use in ELISA, Immunohistochemistry and Western Blot. Other applications not tested. Recommended Dilution: Immunohistochemistry (Formalin fixed paraffin embedded): 3ug/ml Optimal dilutions to be determined by the researcher. AA Sequence: PGSQDVLYINGNGTYSYHSYRGLGGGLLNLNDASSSGPTDLSMKRQLATSSGSSSSSNSRPQLSPTEINAVRQLVAGYRESAAFLLRSADELENLILQQN Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.