130421-ML650
NME2 (Nucleoside Diphosphate Kinase B, NDK B, NDP Kinase B, nm23-H2, C-myc Purine-binding Transcription Factor PUF, NM23B) (MaxLight 650)
Size
£914.00
- SKU:
- 130421-ML650
- Purity:
- Purified by Protein A affinity chromatography.
- Storage Conditions:
- 4°C Do Not Freeze
- Supplier:
- United States Biological
- Host:
- Mouse
- Immunogen:
- Full length recombinant corresponding to aa1-153 from human NME2 (AAH02476) with GST tag. MW of the GST tag alone is 26kD.
- Clone:
- 4B7-3F12
- Format:
- Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight™650.
- Extra Details:
- MaxLight™650 is a new Far-IR stable dye conjugate comparable to Alexa Fluor™647, DyLight™649, Cy5™ and offers better labeling efficiency, brighter imaging and increased immunodetection. Absorbance (655nm); Emission (676nm); Extinction Coefficient 250,000. NM2 is a heterodimeric protein functioning as a nucleoside diphosphate (NDP) kinase. NME1 and NME2 comprise the 152 amino acid A and B polypeptide chains of the NM23 enzyme, respectively. NME2 is identical to the beta subunit of human erythrocyte NDP kinase. NDP kinases are involved in the synthesis of nucleoside triphosphates, and NM23 may act in the regulation of signal transduction by complexing with G proteins, causing activation/inactivation of developmental pathways. NEM2 has been identified as a putative tumor suppressor. High expression of mouse NME2 is detected in heart, liver, and kidney, with moderate expression in skeletal muscle, and negligible expression in other mouse tissues examined. Applications: Suitable for use in FLISA and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: MANLERTFIAIKPDGVQRGLVGEIIKRFEQKGFRLVAMKFLRASEEHLKQHYIDLKDRPFFPGLVKYMNSGPVVAMVWEGLNVVKTGRVMLGETNPADSKPGTIRGDFCIQVGRNIIHGSDSVKSAEKEISLWFKPEELVDYKSCAHDWVYE Storage and Stability: Store product at 4°C in the dark. DO NOT FREEZE! Stable at 4°C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight™650 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap. Note: Applications are based on unconjugated antibody.
- Shipping Conditions:
- Blue Ice