130371-PE

NID2 (Nidogen-2, NID-2, Osteonidogen) (PE)

Size

£914.00

SKU:: 130371-PE
Purity:: Purified by Protein A affinity chromatography.
Storage Conditions:: 4°C Do Not Freeze
Supplier:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant corresponding to aa1276-1375 from human NID2 with GST tag. MW of the GST tag alone is 26kD.
Clone:: 4G8
Format:: Supplied as a liquid in PBS, pH 7.4. No preservative added. Labeled with R-Phycoerythrin (PE).
Extra Details:: Nidogen-2 is a member of the nidogen family of basement membrane proteins. This protein is a cell-adhesion protein that binds collagens I and IV and laminin and may be involved in maintaining the structure of the basement membrane. Nidogen-2 is specific in heart, placenta, bone, and less in pancreas, kidney and skeletal muscle. Applications: Suitable for use in fLISA and Western Blot. Other applications not tested. Recommended Dilutions: Optimal dilutions to be determined by the researcher. Amino Acid Sequence: PNGLTFDPFSKLLCWADAGTKKLECTLPDGTGRRVIQNNLKYPFSIVSYADHFYHTDWRRDGVVSVNKHSGQFTDEYLPEQRSHLYGITAVYPYCPTGRK Storage and Stability: Store product at 4°C in the dark. DO NOT FREEZE! Stable at 4°C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap. Note: Applications are based on unconjugated antibody.