NHP2L1 (NHP2-like Protein 1, High Mobility Group-like Nuclear Protein 2 Homolog 1, OTK27, SNU13 Homolog, hSNU13, U4/U6.U5 tri-snRNP 15.5kD Protein)

Size

£685.00

SKU:: 130363
Purity:: Purified by Protein A affinity chromatography.
Storage Conditions:: -20°C
Supplier:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant corresponding to aa1-100 from human NHP2L1 (AAH05358) with GST tag. MW of the GST tag alone is 26kD.
Clone:: 5C5
Format:: Supplied as a liquid in PBS, pH 7.2.
Extra Details:: Binds to the 5'-stem-loop of U4 snRNA and may play a role in the late stage of spliceosome assembly. The protein undergoes a conformational change upon RNA-binding. Applications: Suitable for use in ELISA. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: MTEADVNPKAYPLADAHLTKKLLDLVQQSCNYKQLRKGANEATKTLNRGISEFIVMAADAEPLEIILHLPLLCEDKNVPYVFVRSKQALGRACGVSRPVI Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.