NFATC2IP (Nuclear Factor Of Activated T-Cells, Cytoplasmic, Calcineurin-Dependent 2 Interacting Protein, FLJ14639, MGC126790, MGC138387)

Size

£685.00

SKU:: 130322
Purity:: Purified by Protein A affinity chromatography.
Storage Conditions:: -20°C
Supplier:: United States Biological
Host:: Mouse
Immunogen:: Full length human NFATC2IP, aa1-138 (AAH21551.1).
Format:: Supplied as a liquid in PBS, pH 7.2.
Extra Details:: Plays a role in the inducible expression of cytokine genes in T-cells, especially by increasing NFAT-driven IL-4 production. Applications: Suitable for use in Immunofluorescence and Western Blot. Other applications not tested. Recommended Dilution: Immunofluorescence: 10ug/ml Optimal dilutions to be determined by the researcher. AA Sequence: MSEPLQSVVDHMATHLGVSPSRILLLFGETELSPTATPRTLKLGVADIIDCVVLTSSPEATETSQQLQLRVQGKEKHQTLEVSLSRDSPLKTLMSHYEEAMGLSGRKLSFFFDGTKLSGRELPADLGMESGDLIEVWG Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months after receipt. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.