130308-HRP
Neurofibromin (NF1, WSS, NFNS, VRNF, NF, Neurofibromin 1, Neurofibromatosis, Type I, von Recklinghausen Disease Neurofibromin, Neurofibromatosis-Noonan Syndrome, WATS, Watson Syndrome) (HRP)
Size
£914.00
- SKU:
- 130308-HRP
- Purity:
- Purified by Protein A affinity chromatography.
- Storage Conditions:
- -20°C
- Supplier:
- United States Biological
- Host:
- Mouse
- Immunogen:
- Partial recombinant corresponding to aa2719-2818 from human NF1 (NP_000258) with GST tag. MW of the GST tag alone is 26kD.
- Clone:
- 2D1
- Format:
- Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with horseradish peroxidase (HRP).
- Extra Details:
- NF1 contains a GTPase-activating protein-related domain (GRD), and is involved in the negative regulation of Ras proteins, by accelerating the hydrolysis of active Ras-guanosine triphosphate. Mutations of NF1 have been reported in Neurofibromatosis type 1, which is characterized by a predisposition to a variety of tumors of the peripheral and central nervous systems as well as myeloid leukemia, cognitive deficits, bone deformations, and pigmentation defects. Applications: Suitable for use in ELISA and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: DTYLPGIDEETSEESLLTPTSPYPPALQSQLSITANLNLSNSMTSLATSQHSPGIDKENVELSPTTGHCNSGRTRHGSASQVQKQRSAGSFKRNSIKKIV Storage and Stability: Store product at 4°C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20°C. Aliquots are stable at -20°C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Note: Applications are based on unconjugated antibody.
- Shipping Conditions:
- Blue Ice