130305-APC

NEUROD2 (Neurogenic Differentiation Factor 2, NeuroD2, Class A Basic Helix-loop-helix Protein 1, bHLHa1, NeuroD-related Factor, NDRF, BHLHA1, NDRF) (APC)

Size

£927.00

SKU:: 130305-APC
Purity:: Purified by Protein A affinity chromatography.
Storage Conditions:: 4°C Do Not Freeze
Supplier:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant corresponding to aa266-375 from human NEUROD2 (NP_006151) with GST tag. MW of the GST tag alone is 26kD.
Clone:: 3E7
Format:: Supplied as a liquid in PBS, pH 7.2. Labeled with Allophycocyanin (APC).
Extra Details:: NeuroD2 is a 41kD nuclear member of the neuroD family of transcription factors. It is expressed in developing and mature neurons such as hippocampal granular neurons, and acts (in part) to repress factors that would otherwise block multipotential cell commitment to a neuronal lineage. NeuroD2 is presumed to act as a heterodimer with other bHLH transcription factors. Human NeuroD2 is 382aa in length. It contains a poly-Glu region aa82-91, an NLS aa107-113, a DNA-binding HLH domain aa119-178 and a poly-Gly segment aa282-285. Based on rat studies, human NeuroD2 will undergo variable phosphorylation in the C-terminal region. Over aa174-382, human and mouse NeuroD2 possess identical aa sequences. Applications: Suitable for use in FLISA and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: RTHGYCAAYETLYAAAGGGGASPDYNSSEYEGPLSPPLCLNGNFSLKQDSSPDHEKSYHYSMHYSALPGSRPTGHGLVFGSSAVRGGVHSENLLSYDMHLHHDRGPMYEE Storage and Stability: Store product at 4°C in the dark. DO NOT FREEZE! Stable at 4°C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: APC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap. Note: Applications are based on unconjugated antibody.

Shipping Conditions:: Blue Ice