130290-BIOTIN

NELL2 (Protein Kinase C-binding Protein NELL2, MEL91 Protein, NEL-like Protein 2, Mel91) (Biotin)

Size

£914.00

SKU:: 130290-BIOTIN
Purity:: Purified by Protein A affinity chromatography.
Storage Conditions:: -20°C
Supplier:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant corresponding to aa301-400 from human NELL2 (NP_006150) with GST tag. MW of the GST tag alone is 26kD.
Clone:: 1F6
Format:: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.
Extra Details:: Protein kinase C-binding protein, NELL2 is expressed abundantly in neural tissues and may play important roles in the development of neural tissues. Also, NELL protein contains six epidermal growth factor (EGF)-like repeat domains that participate in calcium binding. Applications: Suitable for use in ELISA and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: IQCETLICPNPDCPLKSALAYVDGKCCKECKSICQFQGRTYFEGERNTVYSSSGVCVLYECKDQTMKLVESSGCPALDCPESHQITLSHSCCKVCKGYDF Storage and Stability: Store product at 4°C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20°C. Aliquots are stable at -20°C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Note: Applications are based on unconjugated antibody.