130289-BIOTIN

NELL1 (Protein Kinase C-binding Protein NELL1, NEL-like Protein 1, Nel-related Protein 1, NRP1) (Biotin)

Size

£914.00

SKU:: 130289-BIOTIN
Purity:: Purified by Protein A affinity chromatography.
Storage Conditions:: -20°C
Supplier:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant corresponding to aa304-403 from human NELL1 (NP_006148) with GST tag. MW of the GST tag alone is 26kD.
Clone:: 6A8
Format:: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.
Extra Details:: NELL1 (neural EGF-like like protein 1) is an 89kD (predicted) member of the EGF-like domain containing family, Laminin G/NTSP1/Pentraxin gene superfamily of molecules. When secreted, NELL1 exists as a phosphoglycoprotein that can add as much as 50kD to the calculated MW. NELL1 has restricted expression, being limited to pre-B cells and osteoblasts, where it apparently promotes osteoblast maturation and bone formation. In tumors, it is found in neuroblastoma- derived cells. NELL1 is both secreted and retained intracellularly where it is phosphorylated by PKC. The human NELL1 precursor is 810aa in length. It contains a16aa signal sequence plus a 794aa mature region. The mature region possesses an N-terminal TSP domain (aa81-230), two VWFC domains (aa271-390), six consecutive EGF-like domains (aa391-631), and three additional C-terminal VWFC domains (aa632 807). Secreted NELL1 forms a 400-420kD noncovalent homotrimer. Over aa17-810, human NELL1 shares 93% aa identity with mouse and rat NELL1. Alternate splicing generates an additional isoform of human NELL1 hat lacks the fifth EGF-like domain. Applications: Suitable for use in Immunofluorescence, ELISA, Western Blot and Immunoprecipitation. Other applications not tested. Recommended Dilution: Immunofluorescence: 10ug/ml Optimal dilutions to be determined by the researcher. AA Sequence: CRRMSCPPLNCSPDSLPVHIAGQCCKVCRPKCIYGGKVLAEGQRILTKSCRECRGGVLVKITEMCPPLNCSEKDHILPENQCCRVCRGHNFCAEGPKCGE Storage and Stability: Store product at 4°C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20°C. Aliquots are stable at -20°C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Note: Applications are based on unconjugated antibody.

Shipping Conditions:: Blue Ice