NEK10 (Never in Mitosis A-related Kinase 10, NimA-related Protein Kinase 10, FLJ32685, Serine/Threonine Protein Kinase Nek10, FLJ32685)

Size

£685.00

SKU:: 130269
Purity:: Purified by Protein A affinity chromatography.
Storage Conditions:: -20°C
Supplier:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant protein corresponding to aa211-301 from human NEK10 (NP_68974) with GST tag. MW of the GST tag alone is 26kD.
Clone:: 1C9
Format:: Supplied as a liquid in PBS, pH 7.2.
Extra Details:: Belongs to the protein kinase superfamily. Ser/Thr protein kinase family. NIMA subfamily. Applications: Suitable for use in Immunofluorescence, ELISA and Western Blot. Other applications not tested. Recommended Dilution: Immunofluorescence: 10ug/ml Optimal dilutions to be determined by the researcher. AA Sequence: RYFMEANRNTVTCHHELAVLSHETFEKASLSSSSSGAASLKSELSESADLPPEGFQASYGKDEDRACDEILSDDNFNLENAEKDTYSEVD Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.