130262-BIOTIN

NEDD9 (Neural Precursor Cell Expressed Developmentally Down-regulated protein 9, Enhancer of Filamentation 1, hEF1, CRK-associated Substrate-related Protein, CAS-L, CasL, Cas Scaffolding Protein Family Member 2, NEDD-9, Renal Carcinoma Antigen NY-REN-12, p105, CASL, CASS2) (Biotin)

Size

£914.00

SKU:: 130262-BIOTIN
Purity:: Purified
Storage Conditions:: -20°C
Supplier:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant protein corresponding to aa101-200 from human NEDD9 with GST tag. MW of the GST tag alone is 26kD.
Clone:: 1B4
Format:: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.
Extra Details:: NEDD9 (also HEF1 and CASL) is a 93kD (predicted) member of the CAS family of proteins. It is widely expressed, and serves to integrate integrin b1 and BCR signaling with cell mitotic pathways. Human NEDD9 is 834aa in length. It contains one SH3 domain (aa3-65), a Tyr-rich SH2-binding region (aa90-350), one Ser-rich four a-helix bundle protein interaction site (aa350-650), and an HLH motif that mediates Cas protein dimerization (aa710-760). NEDD9 usually runs at 105-115kD in SDS-PAGE due to phosphorylation. It is also cleaved near Leu361 to generate an active N-terminal 55kD fragment. One isoform shows a deletion of aa155-188, while two others show 20-7aa substitutions for aa155-834, 1-153, respectively. Over aa153-366, human and mouse NEDD9 share 85aa identity. Applications: Suitable for use in Immunofluorescence, ELISA and Western Blot. Other applications not tested. Recommended Dilutions: Optimal dilutions to be determined by the researcher. Amino Acid Sequence: PRDTIYQVPPSYQNQGIYQVPTGHGTQEQEVYQVPPSVQRSIGGTSGPHVGKKVITPVRTGHGYVYEYPSRYQKDVYDIPPSHTTQGVYDIPPSSAKGPV Storage and Stability: Store product at 4°C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20°C. Aliquots are stable at -20°C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Note: Applications are based on unconjugated antibody.

Shipping Conditions:: Blue Ice