NEDD1 (Protein NEDD1, Neural Precursor Cell Expressed Developmentally Down-Regulated Protein 1, NEDD-1, FLJ35902, GCP-WD, TUBGCP7)

Size

£685.00

SKU:: 130258
Purity:: Purified by Protein A affinity chromatography.
Storage Conditions:: -20°C
Supplier:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant corresponding to aa561-661 from human NEDD1 (NP_690869) with GST tag. MW of the GST tag alone is 26kD.
Clone:: 7D10
Format:: Supplied as a liquid in PBS, pH 7.2.
Extra Details:: Required for mitosis progression. Promotes the nucleation of microtubules from the spindle. Applications: Suitable for use in ELISA, Western Blot and Immunohistochemistry. Other applications not tested. Recommended Dilution: Immunohistochemistry (Formalin fixed paraffin embedded): 0.75ug/ml Optimal dilutions to be determined by the researcher. AA Sequence: AGVASSLSEKIADSIGNNRQNAPLTSIQIRFIQNMIQETLDDFREACHRDIVNLQVEMIKQFHMQLNEMHSLLERYSVNEGLVAEIERLREENKRLRAHF Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.