130258-BIOTIN

NEDD1 (Protein NEDD1, Neural Precursor Cell Expressed Developmentally Down-Regulated Protein 1, NEDD-1, FLJ35902, GCP-WD, TUBGCP7) (Biotin)

Size

£914.00

SKU:: 130258-BIOTIN
Purity:: Purified by Protein A affinity chromatography.
Storage Conditions:: -20°C
Supplier:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant corresponding to aa561-661 from human NEDD1 (NP_690869) with GST tag. MW of the GST tag alone is 26kD.
Clone:: 7D10
Format:: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.
Extra Details:: Required for mitosis progression. Promotes the nucleation of microtubules from the spindle. Applications: Suitable for use in ELISA, Western Blot and Immunohistochemistry. Other applications not tested. Recommended Dilution: Immunohistochemistry (Formalin fixed paraffin embedded): 0.75ug/ml Optimal dilutions to be determined by the researcher. AA Sequence: AGVASSLSEKIADSIGNNRQNAPLTSIQIRFIQNMIQETLDDFREACHRDIVNLQVEMIKQFHMQLNEMHSLLERYSVNEGLVAEIERLREENKRLRAHF Storage and Stability: Store product at 4°C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20°C. Aliquots are stable at -20°C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Note: Applications are based on unconjugated antibody.