NDST3 (Bifunctional Heparan Sulfate N-deacetylase/N-sulfotransferase 3, Glucosaminyl N-deacetylase/N-sulfotransferase 3, NDST-3, hNDST-3, N-heparan Sulfate Sulfotransferase 3, N-HSST 3, HSST3, UNQ2544/PRO4998, MGC130028, MGC130029)

Size

£685.00

SKU:: 130202
Purity:: Purified by Protein A affinity chromatography.
Storage Conditions:: -20°C
Supplier:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant corresponding to aa162-259 from human NDST3 (NP_004775) with GST tag. MW of the GST tag alone is 26kD.
Clone:: 5B9
Format:: Supplied as a liquid in PBS, pH 7.2.
Extra Details:: Essential bifunctional enzyme that catalyzes both the N-deacetylation and the N-sulfation of glucosamine (GlcNAc) of the glycosaminoglycan in heparan sulfate. Modifies the GlcNAc-GlcA disaccharide repeating sugar backbone to make N-sulfated heparosan, a prerequisite substrate for later modifications in heparin biosynthesis. Has high deacetylase activity but low sulfotransferase activity. Applications: Suitable for use in ELISA and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: IGFHKTSEKSVQSFQLKGFPFSIYGNLAVKDCCINPHSPLIRVTKSSKLEKGSLPGTDWTVFQINHSAYQPVIFAKVKTPENLSPSISKGAFYATIIH Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.