130199-HRP
NDRG2 (Protein NDRG2, N-myc Downstream-regulated Gene 2 Protein, Protein Syld709613, KIAA1248, SYLD, DKFZp781G1938, FLJ25522) (HRP)
Size
£914.00
- SKU:
- 130199-HRP
- Purity:
- Purified by Protein A affinity chromatography.
- Storage Conditions:
- -20°C
- Supplier:
- United States Biological
- Host:
- Mouse
- Immunogen:
- Partial recombinant corresponding to aa1-97 from human NDRG2 (NP_057334) with GST tag. MW of the GST tag alone is 26kD.
- Clone:
- 6A5
- Format:
- Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with horseradish peroxidase (HRP).
- Extra Details:
- NDRG2 (NDRG family member 2) belongs to the N-myc downregulated gene family. It is a cytoplasmic protein which may be involved in dendritic cell and neuron differentiation. It is upregulated at both the RNA and protein levels in Alzheimer's disease. NDRG2 mRNA is downregulated or undetectable in several human cancers and cancer cell-lines, suggesting that it may have anti-tumor activity. Applications: Suitable for use in ELISA and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: MAELQEVQITEEKPLLPGQTPEAAKTHSVETPYGSVTFTVYGTPKPKRPAILTYHDVGLNYKSCFQPLFQFEDMQEIIQNFVRVHVDAPGMEEGAP Storage and Stability: Store product at 4°C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20°C. Aliquots are stable at -20°C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Note: Applications are based on unconjugated antibody.
- Shipping Conditions:
- Blue Ice