NDRG1 (Protein NDRG1, Differentiation-related Gene 1 Protein, DRG-1, N-myc Downstream-regulated Gene 1 Protein, Nickel-specific Induction Protein Cap43, Reducing Agents and Tunicamycin-responsive Protein, RTP, Rit42, CAP43, DRG1)

Size

£685.00

SKU:: 130197
Purity:: Purified by Protein A affinity chromatography.
Storage Conditions:: -20°C
Supplier:: United States Biological
Host:: Mouse
Immunogen:: Full length recombinant corresponding to aa1-394 from NDRG1 (AAH03175) with GST tag. MW of the GST tag alone is 26kD.
Clone:: 2D7
Format:: Supplied as a liquid in PBS, pH 7.2.
Extra Details:: NDRG1 is a member of the emerging NDRG family involved in stress responses, hormone responses, cell growth, and differentiation. The NDRG1 gene is mapped to human chromosome 8q24.2 and encodes a cytosolic protein containing three unique tandem repeats of 10 hydrophilic amino acids near the C-terminus. Expression of NDRG1 is markedly upregulated in various cells under such conditions as cell differentiation, hypoxia and exposure to heavy metals. However, its expression is repressed by the Myc family transcription factors and after cellular transformation. Mutations in the NDRG1 gene are linked to the hereditary motor and sensory neuropathy. The protein is ubiquitously expressed in human and rat heart, brain, kidney, placenta, lung, liver, skeletal muscle, and pancreas. Applications: Suitable for use in Immunofluorescence, ELISA, Western Blot and Immunohistochemistry. Other applications not tested. Recommended Dilution: Immunofluorescence: 10ug/ml Immunohistochemistry (Formalin fixed paraffin embedded): 0.7ug/ml Optimal dilutions to be determined by the researcher. AA Sequence: MSREMQDVDLAEVKPLVEKGETITGLLQEFDVQEQDIETLHGSVHVTLCGTPKGNRPVILTYHDIGMNHKTCYNPLFNYEDMQEITQHFAVCHVDAPGQQDGAASFPAGYMYPSMDQLAEMLPGVLQQFGLKSIIGMGTGAGAYILTRFALNNPEMVEGLVLINVNPCAEGWMDWAASKISGWTQALPDMVVSHLFGKEEMQSNVEVVHTYRQHIVNDMNPGNLHLFINAYNSRRDLEIERPMPGTHTVTLQCPALLVVGDSSPAVDAVVECNSKLDPTKTTLLKMADCGGLPQISQPAKLAEAFKYFVQGMGYMPSASMTRLMRSRTASGSSVTSLDGTRSRSHTSEGTRSRSHTSEGTRSRSHTSEGAHLDITPNSGAAGNSAGPKSMEVSC Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Shipping Conditions:: Blue Ice