NCK1 (Cytoplasmic Protein Nck1, MGC12668, Nck1, Nck-1, Nck Adaptor Protein 1, SH2/SH3 Adaptor Protein NCK-alpha, SH2/SH3 Adaptor Protein NCK-alpha, NCK)

Size

£685.00

SKU:: 130177
Purity:: Purified by Protein A affinity chromatography.
Storage Conditions:: -20°C
Supplier:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant corresponding to aa185-294 from human NCK1 (AAH06403) with GST tag. MW of the GST tag alone is 26kD.
Clone:: 1A1
Format:: Supplied as a liquid in PBS, pH 7.2.
Extra Details:: NCK adaptor protein 1, also known as NCK, belongs to the adaptor family of proteins. The protein encoded by this gene is one of the signaling and transforming proteins containing Src homology 2 and 3 (SH2 and SH3) domains. It is located in the cytoplasm and is an adaptor protein involved in transducing signals from receptor tyrosine kinases to downstream signal recipients such as RAS. Overexpression of Nck resulted in transformation of NIH 3T3 and 3Y1 rat fibroblast. Applications: Suitable for use in ELISA and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: NLNTGQVLHVVQALYPFSSSNDEELNFEKGDVMDVIEKPENDPEWWKCRKINGMVGLVPKNYVTVMQNNPLTSGLEPSPPQCDYIRPSLTGKFAGNPWYYGKVTRHQAEM Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.