NCAPD2 (CAPD2, CNAP1, KIAA0159, Condensin Complex Subunit 1, Chromosome Condensation-related SMC-associated Protein 1, Chromosome-associated Protein D2, hCAP-D2, Non-SMC Condensin I Complex Subunit D2, XCAP-D2 Homolog)

Size

£685.00

SKU:: 130169
Purity:: Purified by Protein A affinity chromatography.
Storage Conditions:: -20°C
Supplier:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant corresponding to aa1240-1339 from CNAP1 (AAH28182) with GST tag. MW of the GST tag alone is 26kD.
Clone:: 4C12
Format:: Supplied as a liquid in PBS, pH 7.2.
Extra Details:: Regulatory subunit of the condensin complex, a complex required for conversion of interphase chromatin into mitotic-like condense chromosomes. The condensin complex probably introduces positive supercoils into relaxed DNA in the presence of type I topoisomerases and converts nicked DNA into positive knotted forms in the presence of type II topoisomerases. May target the condensin complex to DNA via its C-terminal domain. Applications: Suitable for use in ELISA, Immunohistochemistry, Immunofluorescence and Western Blot. Other applications not tested. Recommended Dilution: Immunofluorescence: 10ug/ml Immunohistochemistry (Formalin fixed paraffin embedded): 3ug/ml Optimal dilutions to be determined by the researcher. AA Sequence: LRKMLDNFDCFGDKLSDESIFSAFLSVVGKLRRGAKPEGKAIIDEFEQKLRACHTRGLDGIKELEIGQAGSQRAPSAKKPSSGSRYQPLASTASDNDFVT Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.