NBR1 (Next To BRCA1 Gene 1 Protein, Neighbor Of BRCA1 Gene 1 Protein, Membrane Component Chromosome 17 Surface Marker 2, Protein 1A1-3B, Cell Migration-Inducing Gene 19 Protein, 1A13B, KIAA0049, M17S2, MIG19)

Size

£685.00

SKU:: 130167
Purity:: Purified by Protein A affinity chromatography.
Storage Conditions:: -20°C
Supplier:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant corresponding to aa2-96 from human NBR1 (NP_005890) with GST tag. MW of the GST tag alone is 26kD.
Clone:: 5C3
Format:: Supplied as a liquid in PBS, pH 7.2.
Extra Details:: Next to BRCA1 gene 1 (NBR1) protein is known for its encoding gene proximity to the BRCA1 tumor suppressor gene. N-terminal Phox and Bem1p (PB1) domains of NBR1 mediate its interaction with muscle specific tintin kinase and scaffolding protein p62. NBR1 plays a role in autophagy by facilitating the autophagosomal degradation of ubiquitinated proteins independently and also in concert with p62. Applications: Suitable for use in ELISA and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: EPQVTLNVTFKNEIQSFLVSDPENTTWADIEAMVKVSFDLNTIQIKYLDEENEEVSINSQGEYEEALKMAVKQGNQLQMQVHEGHHVVDEAPPPV Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.