130163-HRP

NAV2 (Neuron Navigator 2, Helicase APC Down-regulated 1, Pore Membrane and/or Filament-interacting-like Protein 2, Retinoic Acid Inducible in Neuroblastoma 1, Steerin-2, Unc-53 Homolog 2, unc53H2, HELAD1, KIAA1419, POMFIL2, RAINB1, STEERIN2, FLJ10633, FLJ11030, FLJ23707, FLJ77876) (HRP)

Size

£914.00

SKU:: 130163-HRP
Purity:: Purified by Protein A affinity chromatography.
Storage Conditions:: -20°C
Supplier:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant protein corresponding to aa1878-1973 from human NAV2 with GST tag. MW of the GST tag alone is 26kD.
Clone:: 4D11
Format:: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with horseradish peroxidase (HRP).
Extra Details:: Possesses 3' to 5' helicase activity and exonuclease activity. Involved in neuronal development, specifically in the development of different sensory organs. Applications: Suitable for use in ELISA and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: TGSTPLLRNSHSNSLISECMDSEAETVMQLRNELRDKEMKLTDIRLEALSSAHQLDQLREAMNRMQSEIEKLKAENDRLKSESQGSGCSRAPSQVS Storage and Stability: Store product at 4°C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20°C. Aliquots are stable at -20°C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Note: Applications are based on unconjugated antibody.