NAT2 (Arylamine N-acetyltransferase 2, Arylamide Acetylase 2, N-acetyltransferase Type 2, NAT-2, Polymorphic Arylamine N-acetyltransferase, PNAT, AAC2)

Size

£685.00

SKU:: 130159
Purity:: Purified by Protein A affinity chromatography.
Storage Conditions:: -20°C
Supplier:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant corresponding to aa96-195 from human NAT2 (AAH15878) with GST tag. MW of the GST tag alone is 26kD.
Clone:: 3B5
Format:: Supplied as a liquid in PBS, pH 7.2.
Extra Details:: NAT2 is an enzyme that functions to both activate and deactivate arylamine and hydrazine drugs and carcinogens. Applications: Suitable for use in ELISA and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: PPVNKYSTGMVHLLLQVTIDGRNYIVDAGSGSSSQMWQPLELISGKDQPQVPCIFCLTEERGIWYLDQIRREQYITNKEFLNSHLLPKKKHQKIYLFTLE Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.