NANOG (Homeobox Protein NANOG, Homeobox Transcription Factor Nanog, hNanog, FLJ12581, FLJ40451)

Size

£685.00

SKU:: 130129
Purity:: Purified by Protein A affinity chromatography.
Storage Conditions:: -20°C
Supplier:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant corresponding to aa98-196 from human NANOG (NP_079141) with GST tag. MW of the GST tag alone is 26kD.
Clone:: 2C11
Format:: Supplied as a liquid in PBS, pH 7.2.
Extra Details:: NANOG is a unique variant of NK2 family of transcription factors. It is a human ortholog of mouse Nanog and consists of a highly conserved homeodomain and Trp-rich repeats. It is specifically expressed by embryonic stem cells and is crucial for second embryonic lineage determination. It works in concert with OCT-4 and SOX-2 and plays a central role in regulating pluripotency and self-renewal of ICM and ES cells. It functions independent of LIF:gp130:Stat3 pathway and prevents differentiation of ES cells to extraembryonic endoderm and trophectoderm lineages. Its expression has also been detected in embryonic carcinoma cells and germ line tumors indicating a therapeutic intervention. Applications: Suitable for use in ELISA and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: TRTVFSSTQLCVLNDRFQRQKYLSLQQMQELSNILNLSYKQVKTWFQNQRMKSKRWQKNNWPKNSNGVTQKASAPTYPSLYSSYHQGCLVNPTGNLPM Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Shipping Conditions:: Blue Ice