130129-ML490
NANOG (Homeobox Protein NANOG, Homeobox Transcription Factor Nanog, hNanog, FLJ12581, FLJ40451) (MaxLight 490)
Size
£914.00
- SKU:
- 130129-ML490
- Purity:
- Purified by Protein A affinity chromatography.
- Storage Conditions:
- 4°C Do Not Freeze
- Supplier:
- United States Biological
- Host:
- Mouse
- Immunogen:
- Partial recombinant corresponding to aa98-196 from human NANOG (NP_079141) with GST tag. MW of the GST tag alone is 26kD.
- Clone:
- 2C11
- Format:
- Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight™490.
- Extra Details:
- MaxLight™490 is a new Blue-Green photostable dye conjugate comparable to DyLight™488, Alexa Fluor™488 and offers better labeling efficiency, brighter imaging and increased immunodetection. Absorbance (491nm); Emission (515nm); Extinction Coefficient 73,000. NANOG is a unique variant of NK2 family of transcription factors. It is a human ortholog of mouse Nanog and consists of a highly conserved homeodomain and Trp-rich repeats. It is specifically expressed by embryonic stem cells and is crucial for second embryonic lineage determination. It works in concert with OCT-4 and SOX-2 and plays a central role in regulating pluripotency and self-renewal of ICM and ES cells. It functions independent of LIF:gp130:Stat3 pathway and prevents differentiation of ES cells to extraembryonic endoderm and trophectoderm lineages. Its expression has also been detected in embryonic carcinoma cells and germ line tumors indicating a therapeutic intervention. Applications: Suitable for use in FLISA and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: TRTVFSSTQLCVLNDRFQRQKYLSLQQMQELSNILNLSYKQVKTWFQNQRMKSKRWQKNNWPKNSNGVTQKASAPTYPSLYSSYHQGCLVNPTGNLPM Storage and Stability: Store product at 4°C in the dark. DO NOT FREEZE! Stable at 4°C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight™490 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap. Note: Applications are based on unconjugated antibody.
- Shipping Conditions:
- Blue Ice