NAB2 (NGFI-A Binding Protein 2, EGR-1-binding Protein 2, Melanoma-associated Delayed Early Response Protein, MADER, Protein MADER, MGC75085, MGC75085)

Size

£685.00

SKU:: 130115
Purity:: Purified by Protein A affinity chromatography.
Storage Conditions:: -20°C
Supplier:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant corresponding to aa421-525 from human NAB2 (NP_005958) with GST tag. MW of the GST tag alone is 26kD.
Clone:: 4H6
Format:: Supplied as a liquid in PBS, pH 7.2.
Extra Details:: NAB2 is a member of the family of NGFI-A binding (NAB) proteins, which function in the nucleus to repress transcription induced by some members of the EGR (early growth response) family of transactivators. NAB proteins can homo- or hetero-multimerize with other EGR or NAB proteins through a conserved N-terminal domain, and repress transcription through two partially redundant C-terminal domains. Transcriptional repression by this protein is mediated in part by interactions with the nucleosome remodeling and deactylase (NuRD) complex. Applications: Suitable for use in ELISA and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: DGHLQAVGSCPRLTPPPADLPLALPAHGLWSRHILQQTLMDEGLRLARLVSHDRVGRLSPCVPAKPPLAEFEEGLLDRCPAPGPHPALVEGRRSSVKVEAEASRQ Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.