130094-ML550
MYOZ1 (Myozenin 1, Myozenin-1, Calsarcin-2, MYOZ Filamin-, actinin- and telethonin-binding Protein, Protein FATZ) (MaxLight 550)
Size
£914.00
- SKU:
- 130094-ML550
- Purity:
- Purified by Protein A affinity chromatography.
- Storage Conditions:
- 4°C Do Not Freeze
- Supplier:
- United States Biological
- Host:
- Mouse
- Immunogen:
- Partial recombinant corresponding to aa200-299 from human MYOZ1 (NP_067068) with GST tag. MW of the GST tag alone is 26kD.
- Clone:
- 1E8
- Format:
- Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight™550.
- Extra Details:
- MaxLight™550 is a new Yellow-Green photostable dye conjugate comparable to Alexa Fluor™546, 555, DyLight™549 , Cy3™, TRITC and offers better labeling efficiency, brighter imaging and increased immunodetection. Absorbance (550nm); Emission (575nm); Extinction Coefficient 150,000. Myozenins may serve as intracellular binding proteins involved in linking Z-disk proteins such as alpha-actinin, gamma-filamin, TCAP/telethonin, LDB3/ZASP and localizing calcineurin signaling to the sarcomere. MYOZ (Myozenin 1) plays an important role in the modulation of calcineurin signaling. MYOZ1 may play a role in myofibrillogenesis. MYOZ1 interacts with ACTN2, ACTN3, FLNA, FLNB, FLNC, LDB3, PPP3CA and TCAP and interacts via its C-terminal region with MYOT. MYOZ1 is localized to the nucleus and pseudopodia of undifferentiated cells and detected throughout the myotubes of differentiated cells. MYOZ1 colocalizes with ACTN2, FLNC and MYOT at the Z-lines of skeletal muscle. MYOZ1 is expressed primarily in skeletal muscle and specifically enriched in the gastrocnemius, which is composed predominantly of fast-twitch muscle fibers. Applications: Suitable for use in FLISA and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: MELGIDLLAYGAKAELPKYKSFNRTAMPYGGYEKASKRMTFQMPKFDLGPLLSEPLVLYNQNLSNRPSFNRTPIPWLSSGEPVDYNVDIGIPLDGETEE Storage and Stability: Store product at 4°C in the dark. DO NOT FREEZE! Stable at 4°C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight™550 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap. Note: Applications are based on unconjugated antibody.
- Shipping Conditions:
- Blue Ice