130091-PE

Myostatin (MSTN, Growth Differentiation Factor 8, Growth/Differentiation Factor 8, GDF8, GDF-8) (PE)

Size

£914.00

SKU:: 130091-PE
Purity:: Purified by Protein A affinity chromatography.
Storage Conditions:: 4°C Do Not Freeze
Supplier:: United States Biological
Host:: Mouse
Immunogen:: Full length recombinant corresponding to aa243-310 from human GDF8 (NP_005250) with GST tag. MW of the GST tag alone is 26kD.
Clone:: 3E7
Format:: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-Phycoerythrin (PE).
Extra Details:: GDF-8, also known as Myostatin, belongs to the TGF-beta superfamily. It is synthesized as an inactive proprotein with the N-terminal pro-region and the C-terminal mature bioactive region. The GDF-8 proregion is capable of associating with active GDF-8 with high affinity and is a potent GDF-8 antagonist. Applications: Suitable for use in FLISA and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: GPGEDGLNPFLEVKVTDTPKRSRRDFGLDCDEHSTESRCCRYPLTVDFEAFGWDWIIAPKRYKANYCS Storage and Stability: Store product at 4°C in the dark. DO NOT FREEZE! Stable at 4°C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap. Note: Applications are based on unconjugated antibody.