130091-ML490
Myostatin (MSTN, Growth Differentiation Factor 8, Growth/Differentiation Factor 8, GDF8, GDF-8) (MaxLight 490)
Size
£914.00
- SKU:
- 130091-ML490
- Purity:
- Purified by Protein A affinity chromatography.
- Storage Conditions:
- 4°C Do Not Freeze
- Supplier:
- United States Biological
- Host:
- Mouse
- Immunogen:
- Full length recombinant corresponding to aa243-310 from human GDF8 (NP_005250) with GST tag. MW of the GST tag alone is 26kD.
- Clone:
- 3E7
- Format:
- Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight™490.
- Extra Details:
- MaxLight™490 is a new Blue-Green photostable dye conjugate comparable to DyLight™488, Alexa Fluor™488 and offers better labeling efficiency, brighter imaging and increased immunodetection. Absorbance (491nm); Emission (515nm); Extinction Coefficient 73,000. GDF-8, also known as Myostatin, belongs to the TGF-beta superfamily. It is synthesized as an inactive proprotein with the N-terminal pro-region and the C-terminal mature bioactive region. The GDF-8 proregion is capable of associating with active GDF-8 with high affinity and is a potent GDF-8 antagonist. Applications: Suitable for use in FLISA and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: GPGEDGLNPFLEVKVTDTPKRSRRDFGLDCDEHSTESRCCRYPLTVDFEAFGWDWIIAPKRYKANYCS Storage and Stability: Store product at 4°C in the dark. DO NOT FREEZE! Stable at 4°C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight™490 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap. Note: Applications are based on unconjugated antibody.
- Shipping Conditions:
- Blue Ice